Populus trichocarpa (black cottonwood): 7463897 Help Entry 7463897           CDS       T01077                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation pop03040   Spliceosome Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     7463897   09123 Folding, sorting and degradation    03018 RNA degradation     7463897  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     7463897    03041 Spliceosome [BR:pop03041]     7463897 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      7463897   mRNA degradation factors    5'-3' decay     Lsm complex      7463897 Spliceosome [BR:pop03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     7463897 SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  7463897 NCBI-ProteinID:  XP_002299989 UniProt:  A0A2K1Z498 A9PC96 LinkDB All DBs Position 1:complement(29131874..29133724) Genome browser AA seq 88 aa AA seqDB search MANTNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEG RRITKLDQILLNGNNIAILVPGGSPDPE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccaacaccaatccctcgcagctcctcccgtcagagctaatagacaggtgcataggg tcgaaaatatgggtgataatgaaaggagacaaggagcttgtcggtactctgaggggattt gatgtctatgtcaacatggtccttgaagacgttactgaatatgaaatcacggctgaaggg cgacggattaccaagcttgatcagatattgctgaatggaaataacattgccattctggtt cctggtggttcccctgatccagaatga

DBGET integrated database retrieval system