Populus trichocarpa (black cottonwood): 7472117 Help Entry 7472117           CDS       T01077                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop04145   Phagosome pop04148   Efferocytosis pop04620   Toll-like receptor signaling pathway pop05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pop00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     7472117    04148 Efferocytosis     7472117  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     7472117  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     7472117  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pop04131]     7472117   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pop04147]     7472117    04031 GTP-binding proteins [BR:pop04031]     7472117 Membrane trafficking [BR:pop04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     7472117  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     7472117   Macropinocytosis    Ras GTPases     7472117  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     7472117 Exosome [BR:pop04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    7472117   Exosomal proteins of other body fluids (saliva and urine)    7472117   Exosomal proteins of colorectal cancer cells    7472117   Exosomal proteins of bladder cancer cells    7472117 GTP-binding proteins [BR:pop04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     7472117 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  7472117 NCBI-ProteinID:  XP_006379285 UniProt:  U5G6M2 LinkDB All DBs Position 9:10902808..10906912 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKAVLQP LKQKKKKKRQAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttcaagattcataaagtgtgtcactgttggtgatggtgctgttggcaagact tgcatgcttatttcctacactagcaacactttccctacggattacgtgccaaccgtgttt gacaatttcagtgcgaatgtggttgtcgatgggagcactgtcaatttagggttgtgggat actgctggccaagaagattacaatagactgaggcctttgagctataggggggcagatgtt ttcctgcttgccttctccctcattagcaaggccagctatgaaaatgttgcaaagaaatgg attcctgaattgaggcattatgcacctggtgttccaattattcttgtcgggacaaagctc gatctccgagatgataagcaattctttatagatcacccaggtgcggtgcccattaccaca gctcagggagaggaactgagaaagctaataggggctcctgtatacattgagtgcagttca aaaacacagcagaatgtcaaagcggtctttgatgcagccattaaggccgtcctccagcct ctgaagcagaagaagaaaaagaagagacaggcacaaaaggcctgctccatattgtga

DBGET integrated database retrieval system