Populus trichocarpa (black cottonwood): 7472117 Help Entry 7472117           CDS       T01077                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop04145   Phagosome pop04148   Efferocytosis pop04517   IgSF CAM signaling pop04518   Integrin signaling pop04620   Toll-like receptor signaling pathway pop05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pop00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     7472117    04518 Integrin signaling     7472117  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     7472117    04148 Efferocytosis     7472117  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     7472117  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     7472117  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pop04131]     7472117   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pop04147]     7472117    04031 GTP-binding proteins [BR:pop04031]     7472117 Membrane trafficking [BR:pop04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     7472117  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     7472117   Macropinocytosis    Ras GTPases     7472117  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     7472117 Exosome [BR:pop04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    7472117   Exosomal proteins of other body fluids (saliva and urine)    7472117   Exosomal proteins of colorectal cancer cells    7472117   Exosomal proteins of bladder cancer cells    7472117 GTP-binding proteins [BR:pop04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     7472117 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  7472117 NCBI-ProteinID:  XP_006379285 UniProt:  U5G6M2 LinkDB All DBs Position 9:10902808..10906912 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKAVLQP LKQKKKKKRQAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttcaagattcataaagtgtgtcactgttggtgatggtgctgttggcaagact tgcatgcttatttcctacactagcaacactttccctacggattacgtgccaaccgtgttt gacaatttcagtgcgaatgtggttgtcgatgggagcactgtcaatttagggttgtgggat actgctggccaagaagattacaatagactgaggcctttgagctataggggggcagatgtt ttcctgcttgccttctccctcattagcaaggccagctatgaaaatgttgcaaagaaatgg attcctgaattgaggcattatgcacctggtgttccaattattcttgtcgggacaaagctc gatctccgagatgataagcaattctttatagatcacccaggtgcggtgcccattaccaca gctcagggagaggaactgagaaagctaataggggctcctgtatacattgagtgcagttca aaaacacagcagaatgtcaaagcggtctttgatgcagccattaaggccgtcctccagcct ctgaagcagaagaagaaaaagaagagacaggcacaaaaggcctgctccatattgtga

DBGET integrated database retrieval system