Populus trichocarpa (black cottonwood): 7475679 Help Entry 7475679           CDS       T01077                                  Name (RefSeq) sm-like protein LSM1B   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     7475679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     7475679 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      7475679   mRNA degradation factors    5'-3' decay     Lsm complex      7475679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq Motif Other DBs NCBI-GeneID:  7475679 NCBI-ProteinID:  XP_002304120 UniProt:  B9GVZ1 LinkDB All DBs Position 3:9556997..9560398 Genome browser AA seq 128 aa AA seqDB search MSWAGPEDIYLSTSLASYLDKKLLVLLRDGRKLMGILRSFDQFANAVLEGACERAIVGDL YCDIHLGLYVIRGENVVLIGELDLEREELPPHMTRVSEAEIKRAQKAEREATDLKGTMRK RMEFLDLD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcttgggcaggcccggaagatatctacctctctacttctcttgctagctatcttgat aagaagcttcttgtgcttctacgagatggccgaaagctcatgggaatacttcgttctttt gaccaatttgccaatgctgttcttgaaggtgcatgtgaaagagctattgttggcgacctt tattgcgacatccacttgggtctatatgtaattcgtggcgagaatgttgtcttaattggg gagctggatttggagagggaggaacttccaccacatatgactcgtgtttcagaagcagaa attaaaagggcacagaaagcagaaagggaggctacagatctcaaaggtacaatgaggaaa agaatggagttccttgatttggattag

DBGET integrated database retrieval system