Populus trichocarpa (black cottonwood): 7480668 Help Entry 7480668           CDS       T01077                                  Name (RefSeq) calmodulin-2/4   KO K02183   calmodulin Organism pop  Populus trichocarpa (black cottonwood) Pathway pop04016   MAPK signaling pathway - plant pop04070   Phosphatidylinositol signaling system pop04075   Plant hormone signal transduction pop04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pop00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     7480668    04070 Phosphatidylinositol signaling system     7480668    04075 Plant hormone signal transduction     7480668  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     7480668  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pop01009]     7480668   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pop04131]     7480668    03036 Chromosome and associated proteins [BR:pop03036]     7480668   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pop04147]     7480668 Protein phosphatases and associated proteins [BR:pop01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      7480668 Membrane trafficking [BR:pop04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     7480668 Chromosome and associated proteins [BR:pop03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      7480668 Exosome [BR:pop04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    7480668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 SPARC_Ca_bdg EF-hand_EFHB_C EH SAPC2_N EF_EFCAB10_C Dockerin_1 DUF5580_M PA_Ig-like PP-binding_2 DUF1400 EF-hand_SWAP70_N DUF7117 TerB YqeY DUF8104 Motif Other DBs NCBI-GeneID:  7480668 NCBI-ProteinID:  XP_002300814 UniProt:  B9GSH7 LinkDB All DBs Position 2:3098248..3099498 Genome browser AA seq 153 aa AA seqDB search MADALAGEQVNVAELREIFSLISIDKVADGFITLEELATIVQSLDRRPTIEEIRDMICEV YIDGNGTLDFEEFLNVMGRKQKENVTEELKEAFKVFDRNQDGYISSSELRQVMMNLGERL TEEEAEQMIREADLDGDGLVSYEEFSRMMAMAF NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcactggctggagaacaggttaacgttgccgagctccgagagatctttagc ttgatatcgattgacaaggttgcagatggtttcattacactggaagaactggcaaccatt gtacaatcgttggatagacgtcccacaatagaagaaattcgagacatgatatgtgaagtt tatattgatggaaatgggacattagattttgaagaattcttgaatgtcatgggaaggaag cagaaggaaaatgttaccgaggaactaaaagaagctttcaaagtttttgataggaaccag gacggatatatttcgtccagcgagctaagacaagtgatgatgaatttgggagagagactg acagaggaagaggctgaacagatgatcagagaggcagatttggacggtgatggtctagtt agctatgaggaattttcaaggatgatggcgatggctttctga

DBGET integrated database retrieval system