Populus trichocarpa (black cottonwood): 7481998 Help Entry 7481998           CDS       T01077                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation pop03040   Spliceosome Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     7481998   09123 Folding, sorting and degradation    03018 RNA degradation     7481998  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     7481998    03041 Spliceosome [BR:pop03041]     7481998 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      7481998   mRNA degradation factors    5'-3' decay     Lsm complex      7481998 Spliceosome [BR:pop03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     7481998 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  7481998 NCBI-ProteinID:  XP_002313290 UniProt:  A9PBG1 LinkDB All DBs Position 9:complement(6511979..6515096) Genome browser AA seq 99 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKT TDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFVQPDGA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtccggaaggaaagaaacagtattggatttggctaagtttgtggacaagggtgttcaa gtcaagctcactggtggtagacaagtgactgggactttgaagggatacgatcaattgcta aaccttgtcctggatgaagcagtagaatttctaagagatgctgatgatccactaaagacc actgaccagacaaggcgccttggcctgattgtttgcaggggaactgcagtgatgctggtg tcaccaactgatggtacggatgagattgccaacccttttgtccagccagatggggcctag

DBGET integrated database retrieval system