Populus trichocarpa (black cottonwood): 7494241 Help Entry 7494241           CDS       T01077                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03083   Polycomb repressive complex pop04120   Ubiquitin mediated proteolysis pop04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     7494241    04120 Ubiquitin mediated proteolysis     7494241   09126 Chromosome    03083 Polycomb repressive complex     7494241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pop04131]     7494241    04121 Ubiquitin system [BR:pop04121]     7494241    03036 Chromosome and associated proteins [BR:pop03036]     7494241 Membrane trafficking [BR:pop04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     7494241 Ubiquitin system [BR:pop04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      7494241    Cul7 complex      7494241 Chromosome and associated proteins [BR:pop03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      7494241   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      7494241 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  7494241 NCBI-ProteinID:  XP_002313704 UniProt:  B9HR50 LinkDB All DBs Position 9:10963685..10965426 Genome browser AA seq 158 aa AA seqDB search MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAENDIPLPNVTSKILAKVIEYC KKHVEADADKDATITGKDEFMKSWDAEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAA DMIKGKTPDEIRKIFNIKNDFTPEEEEEIRRDNQWAFK NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcagaatcaaagaaaatcacgctaaaatcctccgacggcgagacattcgttgtcgaa gaagcggtcgccgttgagtcacagaccatcaaacatatgattgaagatgattgcgccgaa aatgacatcccgttgcctaatgtgacaagcaagattcttgctaaggttatcgagtactgc aagaaacatgtggaagctgatgctgataaagatgcaactattactggaaaggatgagttt atgaagagttgggatgccgagttcgtcaaagttgacaaaaacaccctctttgacctcatc ttggcagcgaactatctgaacatcaaggatttgctagatctgacctgccaagctgcggct gacatgatcaaggggaagactccagacgagatccgtaagatatttaacatcaagaatgac ttcactccagaggaagaagaggagatccgcagagacaaccagtgggcatttaagtga

DBGET integrated database retrieval system