Polymorphobacter sp. PAMC 29334: KZX46_15705 Help Entry KZX46_15705       CDS       T07387                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism poq  Polymorphobacter sp. PAMC 29334 Pathway poq02024   Quorum sensing poq03018   RNA degradation Brite KEGG Orthology (KO) [BR:poq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KZX46_15705 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KZX46_15705 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:poq03019]     KZX46_15705 (hfq)    03036 Chromosome and associated proteins [BR:poq03036]     KZX46_15705 (hfq) Messenger RNA biogenesis [BR:poq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KZX46_15705 (hfq) Chromosome and associated proteins [BR:poq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KZX46_15705 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  QYE36909 LinkDB All DBs Position complement(2534350..2534604) Genome browser AA seq 84 aa AA seqDB search MAEKPSSLQDVFLNTVRKTKTPVTMFLVNGVKLQGNITWFDNFSVLLRRDGSSQLVYKHA ISTVMPAGPIQLFDAEKVDDDGLD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggccgagaagccgagcagcctccaggacgtattcctcaacacggtccgcaagactaag acgcccgtgacgatgttcctcgtcaacggcgtcaagctccagggcaacatcacgtggttc gacaacttctcggtgctgctgcgccgcgatggcagttcgcaactcgtgtacaagcacgcg atctcgaccgtgatgcccgccggcccgatccagttgttcgacgctgaaaaggtcgacgac gacggccttgattga

DBGET integrated database retrieval system