Polymorphobacter sp. PAMC 29334: KZX46_20705 Help Entry KZX46_20705       CDS       T07387                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poq  Polymorphobacter sp. PAMC 29334 Pathway poq01100   Metabolic pathways poq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KZX46_20705    00074 Mycolic acid biosynthesis     KZX46_20705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KZX46_20705 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QYE37001 LinkDB All DBs Position 3567393..3567623 Genome browser AA seq 76 aa AA seqDB search MVAKIADVMVDVFDVDELDITEATSADDVDEWDSLSHIRFIITLERLFKIKFLNEEIADL KNIGDLARVIQAKLPA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atagtcgcaaagatcgccgatgtgatggtcgacgttttcgacgtcgatgaacttgatatt accgaagcaacatcggctgatgatgtcgacgagtgggacagcctaagtcatattcgcttc atcattacactggaacggttgtttaagattaagttcctcaacgaggaaatcgccgacctc aagaatatcggggatctcgcccgggtcatccaggcaaaactgcccgcctga

DBGET integrated database retrieval system