Porphyrobacter sp. CACIAM 03H1: CBR61_08150 Help Entry CBR61_08150       CDS       T09981                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism porc  Porphyrobacter sp. CACIAM 03H1 Brite KEGG Orthology (KO) [BR:porc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:porc03032]     CBR61_08150    03036 Chromosome and associated proteins [BR:porc03036]     CBR61_08150    03400 DNA repair and recombination proteins [BR:porc03400]     CBR61_08150 DNA replication proteins [BR:porc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CBR61_08150 Chromosome and associated proteins [BR:porc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CBR61_08150 DNA repair and recombination proteins [BR:porc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CBR61_08150 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 VWA_3 2C_adapt Motif Other DBs NCBI-ProteinID:  ASJ90892 LinkDB All DBs Position 1712296..1712568 Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADASGLSKNDASNAVESVFDAITKALSGGDEVRLVGFGTFSVAKRKASTG RNPRTGEPMKIKASNQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgaccttatcagcgccgttgccgacgcaagcggactttccaagaacgat gcctcgaatgccgtcgaaagcgtgttcgacgcgatcaccaaggcgctttcgggcggcgac gaggtgcggctggtgggcttcggcaccttctcggtcgccaagcgcaaggcctcgaccggg cgcaacccgcgcaccggcgagccgatgaagatcaaggcttcgaaccagcccaagttcaag gcgggcaagggcctgaaggacgcggtcaactga

DBGET integrated database retrieval system