Porphyrobacter sp. CACIAM 03H1: CBR61_11910 Help Entry CBR61_11910       CDS       T09981                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism porc  Porphyrobacter sp. CACIAM 03H1 Pathway porc00190   Oxidative phosphorylation porc01100   Metabolic pathways Module porc_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:porc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CBR61_11910  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:porc00194]     CBR61_11910 Photosynthesis proteins [BR:porc00194]  Photosystem and electron transport system   F-type ATPase [OT]    CBR61_11910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ASJ91555 UniProt:  A0A2Z2P7Q2 LinkDB All DBs Position complement(2489218..2489442) Genome browser AA seq 74 aa AA seqDB search MDATAAALLGAGLAAIGAGLAALGVGNVFASFLEGALRNPGAADGQQGRLFIGFAAAELL GLLAFVIAVLLIFR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgcaactgctgcagctctcctcggtgccggtctcgccgctatcggcgccggcctc gccgcgctcggcgtgggcaacgtcttcgcctcgttcctcgaaggcgcgctgcgcaacccg ggtgccgccgacggccagcagggccgcctgttcatcggcttcgcggccgccgaacttctc ggcctgctcgccttcgttatcgccgttctgctgatcttccgctaa

DBGET integrated database retrieval system