Porphyrobacter sp. CACIAM 03H1: CBR61_13410 Help Entry CBR61_13410       CDS       T09981                                  Symbol atpC Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism porc  Porphyrobacter sp. CACIAM 03H1 Pathway porc00190   Oxidative phosphorylation porc01100   Metabolic pathways Module porc_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:porc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CBR61_13410 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:porc00194]     CBR61_13410 (atpC) Photosynthesis proteins [BR:porc00194]  Photosystem and electron transport system   F-type ATPase [OT]    CBR61_13410 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  ASJ91820 UniProt:  A0A2Z2PCN1 LinkDB All DBs Position 2801807..2802064 Genome browser AA seq 85 aa AA seqDB search MPLHFELVTPAKLVRSEEVHMVVVPGTEGEFGVLEGHAPFMSTIRDGAVQVFRAAGAAPE VIQVRGGFAEVNEKGLTVLAEHVEG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccctccacttcgaactcgtcacccctgccaagctcgtccgctccgaggaggtccac atggtggtcgtccccggcaccgagggcgaattcggcgtgctcgagggccacgcgcccttc atgagcacgatccgcgacggcgcggtgcaggtcttccgcgccgctggcgcggcgccggag gtgatccaggtgcgcggcggctttgccgaggtgaacgagaagggcctcaccgtccttgcc gagcacgtcgagggctga

DBGET integrated database retrieval system