Porphyrobacter sp. LM 6: BG023_11120 Help Entry BG023_11120       CDS       T04468                                  Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism porl  Porphyrobacter sp. LM 6 Brite KEGG Orthology (KO) [BR:porl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:porl03110]     BG023_11120    03029 Mitochondrial biogenesis [BR:porl03029]     BG023_11120 Chaperones and folding catalysts [BR:porl03110]  Heat shock proteins   HSP10    BG023_11120 Mitochondrial biogenesis [BR:porl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BG023_11120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AOL93078 UniProt:  A0A1D7NH25 LinkDB All DBs Position 116769..117056 Genome browser AA seq 95 aa AA seqDB search MAFRPLHDRVVVRRIEADQKTAGGIIIPDSAQEKPSEGEVIAVGDGARDDSGNRIALDVK VGDRVLFGKWSGTEVKIAGEDLLIMKESDIMGIVG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcatttcgtccgctgcacgaccgcgttgtggtccgtcgcatcgaagccgaccagaag accgctggcggcatcattatccccgatagcgcccaggaaaagccgagcgaaggcgaagtc atcgccgtgggcgacggcgcccgtgacgatagcggcaaccgcatcgcgctcgacgtcaag gtcggcgaccgcgtgctgttcggcaagtggtcgggcaccgaagtcaagatcgctggcgaa gacctgctgatcatgaaggaaagcgacatcatggggatcgtcggctga

DBGET integrated database retrieval system