Porphyrobacter sp. LM 6: BG023_111564 Help Entry BG023_111564      CDS       T04468                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism porl  Porphyrobacter sp. LM 6 Brite KEGG Orthology (KO) [BR:porl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:porl03032]     BG023_111564    03036 Chromosome and associated proteins [BR:porl03036]     BG023_111564    03400 DNA repair and recombination proteins [BR:porl03400]     BG023_111564 DNA replication proteins [BR:porl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BG023_111564 Chromosome and associated proteins [BR:porl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BG023_111564 DNA repair and recombination proteins [BR:porl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BG023_111564 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 VWA_3 HU-CCDC81_euk_1 2C_adapt Motif Other DBs NCBI-ProteinID:  AOL94493 LinkDB All DBs Position 1620902..1621174 Genome browser AA seq 90 aa AA seqDB search MNKNDLISAVADTSGLSKSDAASAVESVFDTITKALSGGDEVRLVGFGTFSVAKRKASTG RNPRTGEPMKIKASIQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgacctgatcagcgccgtcgccgataccagcggtctgtccaagagcgat gccgcgagcgcggttgaaagcgtgttcgacacgattaccaaggccctttcgggcggcgac gaagtgcgtctggtcgggttcggcaccttctcggtggccaagcgcaaggcttcgaccggc cgtaacccgcgcacgggagagccgatgaagatcaaggcgtcgatccagccgaagttcaag gcgggcaagggtctgaaggacgcggtcaactaa

DBGET integrated database retrieval system