Porphyrobacter sp. LM 6: BG023_111623 Help Entry BG023_111623      CDS       T04468                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism porl  Porphyrobacter sp. LM 6 Pathway porl01100   Metabolic pathways porl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:porl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BG023_111623   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BG023_111623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AOL94550 UniProt:  A0A1D7NL96 LinkDB All DBs Position 1678752..1678988 Genome browser AA seq 78 aa AA seqDB search MSDTADRVAKIVVEHLGVEADKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgggtggccaagattgtcgtcgagcatctcggcgtcgaagct gacaaggtgacccaggatgcgagcttcatcgacgatctgggcgctgacagcctcgacatc gtcgaactggtgatggcgttcgaagaggaattcggcgtcgaaatccccgacgatgcggcc gaaaagatcaccaccgttggtgacgcgaccaagtacatcgaggaacacaagggctaa

DBGET integrated database retrieval system