Porphyromonas sp. oral taxon 275: J4862_03795 Help Entry J4862_03795       CDS       T08761                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism porp  Porphyromonas sp. oral taxon 275 Brite KEGG Orthology (KO) [BR:porp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:porp03032]     J4862_03795    03036 Chromosome and associated proteins [BR:porp03036]     J4862_03795    03400 DNA repair and recombination proteins [BR:porp03400]     J4862_03795 DNA replication proteins [BR:porp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     J4862_03795 Chromosome and associated proteins [BR:porp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     J4862_03795 DNA repair and recombination proteins [BR:porp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       J4862_03795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 DUF2267 HU-DNA_bdg DSBA Motif Other DBs NCBI-ProteinID:  QUB43751 LinkDB All DBs Position complement(954884..955153) Genome browser AA seq 89 aa AA seqDB search MNKTDFIAGVAEKAGLTKEQARKAVDAFAAVVAEELQKGEKVSLLGFGTFSVQDKPAREG INPATKAKIKIPARKAVKFKAGAALDLNA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgatttcatcgcaggcgtagctgagaaggctggtctgaccaaggaacag gctcgcaaggctgttgatgcattcgcagcagtagtcgcagaggagctgcagaagggtgag aaggtctctctcctaggcttcggtaccttctccgttcaggataagcccgctcgcgaaggc atcaatcccgccaccaaggcaaagatcaagatccccgcacgcaaggcggtcaagttcaag gctggcgcagctctcgacctgaacgcttaa

DBGET integrated database retrieval system