Polaromonas sp. SP1: DT070_07860 Help Entry DT070_07860       CDS       T05689                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pos  Polaromonas sp. SP1 Pathway pos01100   Metabolic pathways pos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DT070_07860    00074 Mycolic acid biosynthesis     DT070_07860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DT070_07860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Glyco_hydro_63 Motif Other DBs NCBI-ProteinID:  AYQ27943 LinkDB All DBs Position complement(1641138..1641377) Genome browser AA seq 79 aa AA seqDB search MNSDLINLFAETFGISEDKLLPDATLESLGLDSLAVIEFLFQIEDQFGIQIPDQANPPRT LAEMVQLIEPLLPAGKPAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgatttgatcaatctttttgccgagacatttggcatcagcgaagacaaactg ctgccggatgcgacgctggaaagcctggggctcgactcgctggcggtcatcgaattcctg ttccagatcgaagaccagttcggcatccagattcccgaccaggccaacccgccccgcacc cttgcggaaatggtccagctgatcgagcctttgctgccggcgggcaaaccagccgcctga

DBGET integrated database retrieval system