Polaromonas sp. SP1: DT070_12165 Help Entry DT070_12165       CDS       T05689                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pos  Polaromonas sp. SP1 Pathway pos01100   Metabolic pathways pos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DT070_12165    00074 Mycolic acid biosynthesis     DT070_12165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DT070_12165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AYQ28712 LinkDB All DBs Position 2580946..2581185 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEGQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgttaagaaaatcattgccgagcaacttggcgtggaagaa ggccaagtcaccaatgaaaaagcctttgtggccgatctgggcgctgactcgcttgacacc gtagaactggttatggctctggaagacgagtttggcattgagattcccgacgaagacgcc gagaaaatcacgaccgtccagaacgcgattgactacgcaaacacccatcaaaaggcctga

DBGET integrated database retrieval system