Polaromonas sp. SP1: DT070_13040 Help Entry DT070_13040       CDS       T05689                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pos  Polaromonas sp. SP1 Pathway pos00190   Oxidative phosphorylation pos01100   Metabolic pathways Module pos_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pos00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DT070_13040  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pos00194]     DT070_13040 Photosynthesis proteins [BR:pos00194]  Photosystem and electron transport system   F-type ATPase [OT]    DT070_13040 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AYQ28866 LinkDB All DBs Position 2749971..2750207 Genome browser AA seq 78 aa AA seqDB search MTDAGAIAIACGLIIGLGAIGACMGIGAMGGRFLEGAVRQPELMEPLQVKMFLLAGLIDA NFLIGVGIAMMLLFANPL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgactgacgcaggcgccattgccattgcatgtggactgatcatcggcctgggcgccatc ggcgcctgcatgggcatcggggcgatgggagggcgattcctggagggcgccgtgcgccag cccgagttgatggagccgctgcaggtcaagatgtttttgctggcggggctgattgacgcc aacttcctgatcggggtggggatcgccatgatgctgttgttcgccaaccccctgtag

DBGET integrated database retrieval system