KEGG   Porphyrobacter sp. YT40: E2E27_09930
Entry
E2E27_09930       CDS       T06153                                 
Name
(GenBank) AAA family ATPase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
pot  Porphyrobacter sp. YT40
Pathway
pot03420  Nucleotide excision repair
pot03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pot00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    E2E27_09930
   03430 Mismatch repair
    E2E27_09930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pot03400]
    E2E27_09930
Enzymes [BR:pot01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     E2E27_09930
DNA repair and recombination proteins [BR:pot03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     E2E27_09930
   MMR (mismatch excision repair)
    Other MMR factors
     E2E27_09930
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 AAA_12 PcrA_UvrD_tudor Phage_attach AAA_11 Tudor_1_RapA DUF3553
Other DBs
NCBI-ProteinID: QDH34614
LinkDB
Position
complement(2125046..2127349)
AA seq 767 aa
MSQNLPSPAAPPAIPAYAARLNPPQRAAVLATEGPVLMLAGAGTGKTAALTSRLAHLVAT
GRAYPSQILCVTFTNKAAREMRERVGHHLGPAAEGLPWLGTFHSICAKMLRRHAELVGLQ
HNFTIIDTDDQLRVLKALIAEAELDEKRWPARQLAGLIDCWKNRGLNPADLDAAENEAYA
NGQGTALYARYQERLKQLNACDFGDLMLHMLNILRGHPDILADYQRRFRYIMVDEYQDTN
AVQYLWLRLLAQGHKNICVVGDDDQSIYSWRGAEVANILRFEKDFPGAEVIRLEQNYRST
PHILGAASGLIRANSQRHDKTLWTEVNGGDKVKVTGVWDAPEEARRVGEAIERLEREGAS
LGQVAILVRAQYQTREFEDRFIQIGINYRIIGGFRFYERAEIRDALAYLRLVAQPQDDLA
FERIHNQPKRGLGAKALEAMHSHARRTGLPLAAAALQLADSDELPKRAATTIGGLMRQFL
HWREQAETLSPSDLLRLVLEESGYNAMLAADRSAESAGRAENLSELARAMEEYETLGDFL
EHVSLVMDNDRSDSEETVTIMTIHAAKGLEFDNVFCVGWEEGVFPSQRAIDEGGLASLEE
ERRLAYVAITRARRHCTILHAANRRIYGQWISSIPSRFIEDLPEEHIEQETTLTGGASLW
RANWSEQEDPFAHVAQARPDRAQARGPGWQRAIASGYDTTPARVRENTRSAASFAAPARS
DIAIGAMVTHAKFGTGCVIDQEGNKLTIVFEDAGEKRVLDSFVTVVG
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgagccagaacctgccctcccctgccgcaccgccggcgattcccgcctatgccgcgcgg
ctgaacccgccgcagcgcgccgccgtgctggccacggaaggcccggtgctgatgctcgcg
ggcgcaggcacgggcaagaccgccgcgctgacctcgcgcctcgcgcatctggtggcgaca
ggccgcgcttaccccagccagatcctgtgcgtcacgttcaccaacaaggctgcgcgcgag
atgcgcgaacgcgtcggccaccacctcggcccggcggcggaggggctgccgtggctcggc
accttccactcgatctgcgccaagatgctgcgccgccatgccgaactggtggggttgcag
cacaatttcacgatcatcgacaccgacgaccagctgcgtgttctgaaagcactgatcgcc
gaggccgagcttgacgagaagcgctggcccgcgcgccagctggcaggcctgatcgactgc
tggaagaaccgtggcctcaaccccgccgatctcgatgcggccgagaacgaggcctatgcc
aacggccagggcaccgcgctctatgcccgctatcaggagcggctgaagcagctaaacgcc
tgcgatttcggcgatctgatgctgcacatgctcaacatcctgcgcggccatcccgatatc
ctcgccgattaccagcgccgcttccgctacatcatggtggacgaatatcaggacaccaac
gccgtccagtacctgtggctgcggctgctggcacaggggcacaagaacatctgcgtggtg
ggggatgacgaccagtcgatctattcatggcgcggcgcggaagtcgctaatattctcagg
ttcgagaaggattttcccggcgccgaggtgatccggctcgaacagaactaccgctccacc
ccgcacatcctcggcgctgcatccgggctgatccgcgccaattcccagcgccacgacaag
acgctgtggaccgaggtcaatggcggcgacaaggtcaaggtgaccggcgtgtgggacgcg
cccgaggaagcgcgccgggtgggcgaggcgatcgagcggctcgagcgcgagggtgcctcg
ctcggccaggtcgcgattctggtgcgcgcgcagtatcagacgcgcgagttcgaagaccgc
ttcatccagatcggcatcaattaccgcatcatcggcggcttccgcttctacgagcgtgcc
gagatccgcgatgcgctggcctacctgcgccttgtcgcgcagccgcaggacgatctggcg
ttcgagcggatccacaaccagcccaagcgcgggctcggcgccaaggcgcttgaagcgatg
cactcccacgcgcggcgcaccggcctgccgctggcggcggccgcgctgcaactggccgac
agcgacgaattgcccaagcgcgccgcgaccaccatcggcggcttgatgcgccagttcctg
cactggcgcgaacaggccgaaacgctcagcccttccgatctcttgcggcttgtactggag
gaaagcggctacaatgcgatgctcgccgctgaccgctcggcggaaagcgcgggccgtgcg
gaaaacctttccgaactcgcgcgcgcgatggaggaatacgaaacgctcggcgatttcctc
gagcatgtcagccttgtcatggacaatgaccggtcggacagcgaggagacggtgacgatc
atgacgatccacgccgcgaaggggctggaattcgataacgttttctgcgtcggctgggag
gaaggcgtgttcccctcgcaacgcgcgatcgacgagggcgggctcgcgtcgctggaggaa
gaacgccgcctcgcctatgtcgcgatcacccgcgcgcggcggcattgcaccatcctccac
gccgccaaccggcgcatctatggccagtggatcagctccatcccctcacgcttcatcgaa
gacttgcccgaggaacacatcgagcaggaaaccacgctcaccggcggcgcatcgctgtgg
cgggccaactggagcgagcaggaagaccccttcgcgcatgtcgcacaggcccgcccggac
cgcgcccaggcacgcgggcccggttggcagcgtgcgatcgccagcggctacgacaccacc
cctgcccgcgtgcgcgaaaacacccgctccgccgccagcttcgccgctcccgcgcgcagc
gacatcgcgatcggcgcgatggtcacccacgccaagttcggcacgggctgcgtcatcgat
caggagggcaacaagctcaccatcgtcttcgaggacgcaggagagaagcgcgtgctcgac
agcttcgtgacggtggttggttag

DBGET integrated database retrieval system