Porphyrobacter sp. YT40: E2E27_10045 Help Entry E2E27_10045       CDS       T06153                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pot  Porphyrobacter sp. YT40 Pathway pot00190   Oxidative phosphorylation pot01100   Metabolic pathways Module pot_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pot00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     E2E27_10045  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pot00194]     E2E27_10045 Photosynthesis proteins [BR:pot00194]  Photosystem and electron transport system   F-type ATPase [OT]    E2E27_10045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QDH34632 LinkDB All DBs Position 2147894..2148118 Genome browser AA seq 74 aa AA seqDB search MDATAAALLGAGLAAIGAGMAALGVGNVFASFLEGALRNPGAADGQQGRLFIGFAAAELL GLLAFVIAVLLIFR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgcaactgcagctgctctcctcggtgccggtctcgcagcgatcggtgccggcatg gccgcgctgggcgtgggcaacgtgtttgcctcgttcctcgaaggcgcgctgcgcaacccg ggtgctgccgacggccagcagggccgcctgttcatcggcttcgcggccgccgaacttctc ggcctgctcgccttcgttatcgccgttctgctgatcttccgctaa

DBGET integrated database retrieval system