Plecotus auritus (brown big-eared bat): 308255562 Help Entry 308255562         CDS       T11911                                  Symbol BCL2L1, AC0HY7_022395 Name (RefSeq) bcl-2-like protein 1 isoform 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pots  Plecotus auritus (brown big-eared bat) Pathway pots01521   EGFR tyrosine kinase inhibitor resistance pots01524   Platinum drug resistance pots04014   Ras signaling pathway pots04064   NF-kappa B signaling pathway pots04115   p53 signaling pathway pots04137   Mitophagy - animal pots04140   Autophagy - animal pots04151   PI3K-Akt signaling pathway pots04210   Apoptosis pots04215   Apoptosis - multiple species pots04621   NOD-like receptor signaling pathway pots04630   JAK-STAT signaling pathway pots05012   Parkinson disease pots05014   Amyotrophic lateral sclerosis pots05022   Pathways of neurodegeneration - multiple diseases pots05145   Toxoplasmosis pots05162   Measles pots05166   Human T-cell leukemia virus 1 infection pots05168   Herpes simplex virus 1 infection pots05170   Human immunodeficiency virus 1 infection pots05200   Pathways in cancer pots05202   Transcriptional misregulation in cancer pots05212   Pancreatic cancer pots05220   Chronic myeloid leukemia pots05222   Small cell lung cancer pots05225   Hepatocellular carcinoma pots05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pots00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     308255562 (BCL2L1)    04630 JAK-STAT signaling pathway     308255562 (BCL2L1)    04064 NF-kappa B signaling pathway     308255562 (BCL2L1)    04151 PI3K-Akt signaling pathway     308255562 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     308255562 (BCL2L1)    04137 Mitophagy - animal     308255562 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     308255562 (BCL2L1)    04215 Apoptosis - multiple species     308255562 (BCL2L1)    04115 p53 signaling pathway     308255562 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     308255562 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     308255562 (BCL2L1)    05202 Transcriptional misregulation in cancer     308255562 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     308255562 (BCL2L1)    05225 Hepatocellular carcinoma     308255562 (BCL2L1)    05220 Chronic myeloid leukemia     308255562 (BCL2L1)    05222 Small cell lung cancer     308255562 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     308255562 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     308255562 (BCL2L1)    05162 Measles     308255562 (BCL2L1)    05168 Herpes simplex virus 1 infection     308255562 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     308255562 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     308255562 (BCL2L1)    05014 Amyotrophic lateral sclerosis     308255562 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     308255562 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     308255562 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     308255562 (BCL2L1)    01524 Platinum drug resistance     308255562 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pots01009]     308255562 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pots03036]     308255562 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pots02000]     308255562 (BCL2L1) Protein phosphatases and associated proteins [BR:pots01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      308255562 (BCL2L1) Chromosome and associated proteins [BR:pots03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     308255562 (BCL2L1) Transporters [BR:pots02000]  Other transporters   Pores ion channels [TC:1]    308255562 (BCL2L1) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  308255562 NCBI-ProteinID:  XP_080539294 LinkDB All DBs Position 8:64418655..64466667 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccctgcggtgaatggagccactggccacagcagtagcttggatgcccgggaggtg attcccatggcagcggtgaagcaagcgctgagggaggcgggcgatgagtttgaactgagg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaagtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctcgttcggtggggcactgtgcgtggaaagtgtggacaaggagatgcag gtattggtgagtcggattgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggaacgcttcaatcgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system