Penicillium oxalicum: POX_c04704 Help Entry POX_c04704        CDS       T09521                                  Name (RefSeq) Cell division control protein   KO K04393   cell division control protein 42 Organism pou  Penicillium oxalicum Pathway pou04011   MAPK signaling pathway - yeast pou04144   Endocytosis pou04517   IgSF CAM signaling pou04518   Integrin signaling pou05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pou00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     POX_c04704   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     POX_c04704    04518 Integrin signaling     POX_c04704  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     POX_c04704  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     POX_c04704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pou04131]     POX_c04704    03036 Chromosome and associated proteins [BR:pou03036]     POX_c04704   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pou04147]     POX_c04704    04031 GTP-binding proteins [BR:pou04031]     POX_c04704 Membrane trafficking [BR:pou04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     POX_c04704  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     POX_c04704   Macropinocytosis    Ras GTPases     POX_c04704 Chromosome and associated proteins [BR:pou03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     POX_c04704 Exosome [BR:pou04147]  Exosomal proteins   Exosomal proteins of microglial cells    POX_c04704   Exosomal proteins of breast milk    POX_c04704 GTP-binding proteins [BR:pou04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     POX_c04704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  74436971 NCBI-ProteinID:  XP_049971122 LinkDB All DBs Position III:complement(<3761606..>3762399) Genome browser AA seq 178 aa AA seqDB search MDSSTPCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDTA GQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTDL RDDPSVREKLSRQKMQPIRKEDGDRMAKELGAVKYVECSALTQYKLKDVFDEVREYPD NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atggattcctccactccgtgtgtcgtggtcggtgacggtgccgtcgggaaaacgtgcttg ctcatctcgtacacaaccaacaagttcccctccgaatatgttccgaccgtctttgacaac tatgcggtgactgtcatgatcggggatgagccctataccttgggattgttcgatactgcc ggtcaggaggattacgatcgcctgcgtcccttgtcgtacccgcagaccgacgtcttcctc gtctgcttctccgtcacgtctccggcctcctttgagaacgtgcgggaaaagtggttcccc gaggtgcaccaccactgccccggtgtgccctgtctgattgtcggcacccagaccgatttg cgcgacgatcccagtgttcgcgagaagctttcccgtcagaagatgcagcccattcgaaag gaggacggtgatcggatggcgaaggaactgggagcggtcaaatacgtcgagtgctcggcg ctgacgcagtacaagctgaaggatgtctttgacgaggtacgtgaatatcccgactga

DBGET integrated database retrieval system