Penicillium oxalicum: POX_e06613 Help Entry POX_e06613        CDS       T09521                                  Name (RefSeq) GTP-binding protein rhoA   KO K04513   Ras homolog gene family, member A Organism pou  Penicillium oxalicum Pathway pou04011   MAPK signaling pathway - yeast pou04081   Hormone signaling pou04144   Endocytosis pou05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pou00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     POX_e06613   09133 Signaling molecules and interaction    04081 Hormone signaling     POX_e06613  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     POX_e06613  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     POX_e06613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pou04131]     POX_e06613   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pou04147]     POX_e06613    04031 GTP-binding proteins [BR:pou04031]     POX_e06613 Membrane trafficking [BR:pou04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     POX_e06613 Exosome [BR:pou04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    POX_e06613   Exosomal proteins of other body fluids (saliva and urine)    POX_e06613   Exosomal proteins of colorectal cancer cells    POX_e06613   Exosomal proteins of bladder cancer cells    POX_e06613 GTP-binding proteins [BR:pou04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     POX_e06613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB NB-ARC Motif Other DBs NCBI-GeneID:  74438835 NCBI-ProteinID:  XP_049967890 LinkDB All DBs Position V:1646570..1647583 Genome browser AA seq 196 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKD LRHDPKTIEELHKTSQSPVTAEQGEEVRKKIGAYKYLECSARTNEGVREVFEAATRAALL KVGKTKQKKGTKCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggccgagatccgtcgcaagctcgtcatcgtcggcgatggtgcctgcggtaagacctgt ctgctcattgtcttctccaagggcacattccctgaggtctacgtccccaccgtcttcgag aactatgtcgccgatgtcgaggtcgatggcaagcacgttgagctcgctctctgggataca gctggccaagaagattatgaccgtctccgacccctgtcataccccgactctcacgtgatc cttatctgtttcgctgtcgactcccccgattccctcgataacgttcaggagaagtggatt tccgaggtcctccacttctgccagggtctccctatcattctggtcggctgtaagaaggat ctgcgccacgaccctaagaccattgaggagctccacaagacctcccagagccccgtcacc gctgaacagggtgaggaggtccgcaagaagattggtgcctacaagtaccttgagtgctct gctcgcaccaatgagggtgttcgcgaggtcttcgaggctgccactcgtgccgctctcctg aaggttggcaagaccaagcagaagaagggaaccaagtgcagtatcctgtaa

DBGET integrated database retrieval system