Paenibacillus sp. 32O-W: IJ21_13660 Help Entry IJ21_13660        CDS       T04219                                  Name (GenBank) sporulation inhibitor A   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism pow  Paenibacillus sp. 32O-W Brite KEGG Orthology (KO) [BR:pow00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     IJ21_13660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  ALS26770 UniProt:  A0A0U2L8V4 LinkDB All DBs Position 1527065..1527208 Genome browser AA seq 47 aa AA seqDB search MELLSDELLVDTYFAAIQYKLDPEFIRLLAIELKRRKINPEAYEIGA NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atggagctgctttctgacgagcttctggtcgatacgtatttcgccgcgattcaatacaag ctggatcccgaatttattcgtcttctggcaatcgaattgaagcggagaaaaattaatccg gaagcttatgaaatcggcgcctga

DBGET integrated database retrieval system