Pandoraea oxalativorans: MB84_03500 Help Entry MB84_03500        CDS       T03840                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pox  Pandoraea oxalativorans Pathway pox00998   Biosynthesis of various antibiotics pox01100   Metabolic pathways pox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MB84_03500    00074 Mycolic acid biosynthesis     MB84_03500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MB84_03500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKC68725 UniProt:  A0A0E3YAA5 LinkDB All DBs Position 5362440..5362661 Genome browser AA seq 73 aa AA seqDB search MENFYAELAEVLEIDPATVGPDMALAEHNWDSLAIVSTIAIVDEIFNVTLDGSALGKCEK VSDIEALIEKAKA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttttacgccgaactcgcagaagtactggaaatcgacccggcaaccgtcggc ccggacatggcgctggcagagcacaactgggactcgcttgcaatcgtctcgaccattgcc atcgtcgatgaaatcttcaacgtgaccctcgatggctcggccctcggcaagtgcgaaaag gtttcggacatcgaggctttgatcgagaaggccaaagcatga

DBGET integrated database retrieval system