Pontivivens ytuae: I0K15_01965 Help Entry I0K15_01965       CDS       T06919                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poz  Pontivivens ytuae Pathway poz01100   Metabolic pathways poz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I0K15_01965    00074 Mycolic acid biosynthesis     I0K15_01965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I0K15_01965 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QPH54572 UniProt:  A0A7S9LSN7 LinkDB All DBs Position complement(427375..427641) Genome browser AA seq 88 aa AA seqDB search MSDEVTEKMRAIIAEQAVLDPSEVGMDATLDDLGIDSLGLVEAVFAIEEEFDVQVPFNAN DPADSDFDITNVQSMVNAVKALVAEKAG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgaagtgaccgagaaaatgcgcgccatcatcgccgagcaggccgtgctcgac ccgtccgaggtcggcatggacgcaacgctcgatgatctcgggatcgacagcctcggcctc gtcgaggcggtcttcgccatcgaggaggagttcgacgtccaggtcccgttcaacgcgaac gatcccgcggactccgatttcgacatcaccaacgttcagagcatggtgaacgcggtcaag gcgctggtcgcggaaaaagccggctga

DBGET integrated database retrieval system