Pontivivens ytuae: I0K15_11345 Help Entry I0K15_11345       CDS       T06919                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism poz  Pontivivens ytuae Brite KEGG Orthology (KO) [BR:poz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:poz03032]     I0K15_11345    03036 Chromosome and associated proteins [BR:poz03036]     I0K15_11345    03400 DNA repair and recombination proteins [BR:poz03400]     I0K15_11345 DNA replication proteins [BR:poz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I0K15_11345 Chromosome and associated proteins [BR:poz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I0K15_11345 DNA repair and recombination proteins [BR:poz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I0K15_11345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QPH52420 UniProt:  A0A7S9LP66 LinkDB All DBs Position complement(2342659..2342949) Genome browser AA seq 96 aa AA seqDB search MAQKPMTKTQLVAALAEQTGSDKKSATEFLDALSDVVTKEVAAGGAVTIPNIGKVFCRDR PERMVRNPATGEQMKKEADRAVKVTIAKALKDQVNA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcacaaaaaccgatgacgaagacgcagctcgtggctgccctcgccgagcagaccggc agcgacaagaagtcggctaccgagttcctggacgccctgtccgacgtcgtgaccaaggaa gtcgccgcgggcggcgctgtgacgatcccgaacatcggcaaggtgttctgccgcgaccgg cccgagcgcatggtccgcaaccccgccacgggcgagcagatgaagaaggaagccgatcgc gccgtgaaggtcacgatcgccaaggcattgaaggatcaggtgaacgcctga

DBGET integrated database retrieval system