Pontivivens ytuae: I0K15_11375 Help Entry I0K15_11375       CDS       T06919                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism poz  Pontivivens ytuae Brite KEGG Orthology (KO) [BR:poz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:poz03110]     I0K15_11375 (groES)    03029 Mitochondrial biogenesis [BR:poz03029]     I0K15_11375 (groES) Chaperones and folding catalysts [BR:poz03110]  Heat shock proteins   HSP10    I0K15_11375 (groES) Mitochondrial biogenesis [BR:poz03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     I0K15_11375 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QPH52426 UniProt:  A0A7S9LNL1 LinkDB All DBs Position 2350079..2350366 Genome browser AA seq 95 aa AA seqDB search MNFTPLHDRVLVRRLESDEKTAGGLIIPDSAKEKPAEGEVIAVGAGAKDDDGDRIAMDVK AGDKILFGKWSGTEIKIDGEELLIMKESDILGILA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacttcaccccgctgcacgaccgtgtcctggtacgtcgccttgagagcgacgagaag accgcaggcggcctcatcatccccgacagcgccaaggaaaagcccgccgagggcgaggtc atcgcagtcggcgcaggtgccaaggacgatgacggcgaccgcatcgcgatggacgtgaaa gccggcgacaagatcctgttcggcaagtggtccggcaccgagatcaagatcgacggcgaa gagctgctgatcatgaaggagagcgacatcctcggcatcctcgcctga

DBGET integrated database retrieval system