KEGG   Pontivivens ytuae: I0K15_15640
Entry
I0K15_15640       CDS       T06919                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
poz  Pontivivens ytuae
Pathway
poz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:poz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I0K15_15640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:poz02000]
    I0K15_15640
Enzymes [BR:poz01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     I0K15_15640
Transporters [BR:poz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    I0K15_15640
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_23 AAA_25 AAA_16 AAA_15 AAA_22 AAA_33 ORC-CDC6-like NACHT MMR_HSR1 Mg_chelatase AAA_30 AAA_19 RsgA_GTPase AAA_28
Other DBs
NCBI-ProteinID: QPH53213
UniProt: A0A7S9QBT2
LinkDB
Position
3157879..3158679
AA seq 266 aa
MNKVGTGTEAVSAVAVAPVPAIRADALSKSYDPARPVLRDISLAIRPGERVALIGPNGSG
KSTLLRCLIGLHAPSGGTLEVLGQPLHGHATRRARAHVRGRTGMVFQHHALVRRRVALSN
VLHGLLHRPGGWRALSHQTAPSDWRARGMAALEAVGLADRALDRVDALSGGQQQRVAIAR
ALVRDPEFLIADEPAASLDPAAGRDVMALFARLCAERGITLLYTSHDMAHARDYSDRIVA
LRDGQVQFDTPSHDLSAEHLQESFDG
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaacaaggtcggcaccgggacggaggcggtatcggcagttgccgtggcgccggtgccg
gccatccgtgcggacgctctgagcaagagctacgaccccgcgcgccccgttctgcgggac
atctccctcgcgatccgtcccggcgagcgcgttgccctgatcgggccgaacgggtcaggc
aaatcgacactgctgcgctgcctcatcggcctgcacgcgccgagcggcggcacgctggag
gtgctcggccaaccgctccacggccacgccacgcgccgggcgcgggcgcatgtgcgcggg
cggaccggaatggtcttccagcatcacgcgctggtccggcggcgggtggcactctccaac
gtgctgcacggtctgctccaccggcccggcggctggcgggcgctgtcgcatcagacggcc
ccgtccgattggcgggcgcgggggatggctgcgctggaggccgtgggcctcgccgaccgc
gccctcgaccgggtcgacgcgctgtcgggcggccagcagcagcgcgtcgccatcgcccgc
gcgttggtgcgcgatccggagttcctgatcgccgatgagcctgccgcgagtctcgatcct
gccgccggacgggacgtcatggcgctcttcgcccggctctgtgccgagcgcggcatcacg
ctgctctacacctcccacgacatggcccatgcccgcgactactccgaccggatcgtcgcc
ttacgcgacgggcaggtgcagttcgacacgccgagccacgatctgtcggcggagcacctg
caggagagtttcgatggctga

DBGET integrated database retrieval system