Pseudomonas paraeruginosa: B7D75_10350 Help Entry B7D75_10350       CDS       T08722                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppaa  Pseudomonas paraeruginosa Pathway ppaa01100   Metabolic pathways ppaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B7D75_10350    00074 Mycolic acid biosynthesis     B7D75_10350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B7D75_10350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AVR67339 LinkDB All DBs Position 2158261..2158497 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcagtaa

DBGET integrated database retrieval system