Palaeococcus pacificus: PAP_00770 Help Entry PAP_00770         CDS       T03210                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ppac  Palaeococcus pacificus Pathway ppac03010   Ribosome Brite KEGG Orthology (KO) [BR:ppac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PAP_00770   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PAP_00770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ppac03011]     PAP_00770    04121 Ubiquitin system [BR:ppac04121]     PAP_00770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppac04147]     PAP_00770 Ribosome [BR:ppac03011]  Ribosomal proteins   Eukaryotes    Small subunit     PAP_00770   Archaea     PAP_00770 Ubiquitin system [BR:ppac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PAP_00770 Exosome [BR:ppac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PAP_00770   Exosomal proteins of colorectal cancer cells    PAP_00770 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_RPB9 Zn_ribbon_11 GFA Lar_restr_allev DUF4467 MqsA_antitoxin Zn_Ribbon_1 Zn_ribbon_IS1595 DZR Zn_ribbon_NUD Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AIF68597 UniProt:  A0A075LRN4 LinkDB All DBs Position complement(144981..145154) Genome browser AA seq 57 aa AA seqDB search MAGKKKATQKWKYYEVKGDKVERKKKFCPRCGPGIFMAEHKDRWSCGRCGYTEWKRK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggctggtaaaaagaaggctacccaaaagtggaagtactatgaggtcaagggcgacaag gtcgagagaaagaagaagttctgcccaaggtgcggccccggaatatttatggccgaacac aaggatcgctggagctgcggacgctgcggctacacagagtggaagaggaagtga

DBGET integrated database retrieval system