Panthera pardus (leopard): 109245368 Help Entry 109245368         CDS       T06062                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism ppad  Panthera pardus (leopard) Pathway ppad04814   Motor proteins ppad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppad00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     109245368 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109245368 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ppad03037]     109245368 (DYNLT1)    04812 Cytoskeleton proteins [BR:ppad04812]     109245368 (DYNLT1) Cilium and associated proteins [BR:ppad03037]  Motile cilia and associated proteins   Dynein arm    109245368 (DYNLT1) Cytoskeleton proteins [BR:ppad04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109245368 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  109245368 NCBI-ProteinID:  XP_019268230 Ensembl:  ENSPPRG00000005411 UniProt:  A0A9V1DVF8 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgccgaggagactgcttttgttgttgatgaagtgagcaacatt gtaaaagaggctatagaaagtgcaatcggtggcaacgcctatcagcacagcaaagtgaac cagtggaccacaaacgtagtcgaacagactttaagccaactcaccaagctgggcaagcca tttaaatacatcgtgacctgtgtaattatgcagaagaacggagcagggttacacacggca agttcctgcttctgggacagctctacggacggcagctgcactgtgcggtgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system