Panthera pardus (leopard): 109247530 Help Entry 109247530         CDS       T06062                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ppad  Panthera pardus (leopard) Pathway ppad04140   Autophagy - animal ppad04144   Endocytosis ppad04152   AMPK signaling pathway ppad04530   Tight junction ppad04972   Pancreatic secretion ppad05014   Amyotrophic lateral sclerosis ppad05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     109247530 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109247530 (RAB8A)    04140 Autophagy - animal     109247530 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     109247530 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     109247530 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109247530 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     109247530 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109247530 (RAB8A)    03036 Chromosome and associated proteins [BR:ppad03036]     109247530 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109247530 (RAB8A)    04031 GTP-binding proteins [BR:ppad04031]     109247530 (RAB8A) Membrane trafficking [BR:ppad04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     109247530 (RAB8A)  Autophagy   Other autophagy associated proteins     109247530 (RAB8A) Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109247530 (RAB8A) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109247530 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    109247530 (RAB8A)   Exosomal proteins of colorectal cancer cells    109247530 (RAB8A) GTP-binding proteins [BR:ppad04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     109247530 (RAB8A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  109247530 NCBI-ProteinID:  XP_019271711 Ensembl:  ENSPPRG00000018809 UniProt:  A0A9V1E0T9 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgcgttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaatattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgacgtgaacgacaagagacaagtgtccaaggaacggggagagaagctcgcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaactggaaggcaac agtccccaagggagcagccagggagtcaaaatcaccccagaccagcagaagagaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system