Panthera pardus (leopard): 109247805 Help Entry 109247805         CDS       T06062                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ppad  Panthera pardus (leopard) Pathway ppad04014   Ras signaling pathway ppad04015   Rap1 signaling pathway ppad04022   cGMP-PKG signaling pathway ppad04024   cAMP signaling pathway ppad04062   Chemokine signaling pathway ppad04071   Sphingolipid signaling pathway ppad04072   Phospholipase D signaling pathway ppad04081   Hormone signaling ppad04144   Endocytosis ppad04150   mTOR signaling pathway ppad04270   Vascular smooth muscle contraction ppad04310   Wnt signaling pathway ppad04350   TGF-beta signaling pathway ppad04360   Axon guidance ppad04510   Focal adhesion ppad04520   Adherens junction ppad04530   Tight junction ppad04611   Platelet activation ppad04621   NOD-like receptor signaling pathway ppad04625   C-type lectin receptor signaling pathway ppad04660   T cell receptor signaling pathway ppad04670   Leukocyte transendothelial migration ppad04722   Neurotrophin signaling pathway ppad04810   Regulation of actin cytoskeleton ppad04921   Oxytocin signaling pathway ppad04928   Parathyroid hormone synthesis, secretion and action ppad04972   Pancreatic secretion ppad05100   Bacterial invasion of epithelial cells ppad05132   Salmonella infection ppad05133   Pertussis ppad05135   Yersinia infection ppad05152   Tuberculosis ppad05163   Human cytomegalovirus infection ppad05200   Pathways in cancer ppad05203   Viral carcinogenesis ppad05205   Proteoglycans in cancer ppad05206   MicroRNAs in cancer ppad05210   Colorectal cancer ppad05417   Lipid and atherosclerosis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109247805 (RHOA)    04015 Rap1 signaling pathway     109247805 (RHOA)    04310 Wnt signaling pathway     109247805 (RHOA)    04350 TGF-beta signaling pathway     109247805 (RHOA)    04072 Phospholipase D signaling pathway     109247805 (RHOA)    04071 Sphingolipid signaling pathway     109247805 (RHOA)    04024 cAMP signaling pathway     109247805 (RHOA)    04022 cGMP-PKG signaling pathway     109247805 (RHOA)    04150 mTOR signaling pathway     109247805 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     109247805 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109247805 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109247805 (RHOA)    04520 Adherens junction     109247805 (RHOA)    04530 Tight junction     109247805 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109247805 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109247805 (RHOA)    04621 NOD-like receptor signaling pathway     109247805 (RHOA)    04625 C-type lectin receptor signaling pathway     109247805 (RHOA)    04660 T cell receptor signaling pathway     109247805 (RHOA)    04670 Leukocyte transendothelial migration     109247805 (RHOA)    04062 Chemokine signaling pathway     109247805 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     109247805 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     109247805 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     109247805 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     109247805 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     109247805 (RHOA)   09158 Development and regeneration    04360 Axon guidance     109247805 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109247805 (RHOA)    05206 MicroRNAs in cancer     109247805 (RHOA)    05205 Proteoglycans in cancer     109247805 (RHOA)    05203 Viral carcinogenesis     109247805 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     109247805 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     109247805 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     109247805 (RHOA)    05135 Yersinia infection     109247805 (RHOA)    05133 Pertussis     109247805 (RHOA)    05152 Tuberculosis     109247805 (RHOA)    05100 Bacterial invasion of epithelial cells     109247805 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109247805 (RHOA)    05418 Fluid shear stress and atherosclerosis     109247805 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109247805 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109247805 (RHOA)    04031 GTP-binding proteins [BR:ppad04031]     109247805 (RHOA) Membrane trafficking [BR:ppad04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     109247805 (RHOA) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109247805 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    109247805 (RHOA)   Exosomal proteins of colorectal cancer cells    109247805 (RHOA)   Exosomal proteins of bladder cancer cells    109247805 (RHOA) GTP-binding proteins [BR:ppad04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     109247805 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  109247805 NCBI-ProteinID:  XP_019272362 Ensembl:  ENSPPRG00000024656 UniProt:  A0A9V1E1V8 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system