Panthera pardus (leopard): 109251958 Help Entry 109251958         CDS       T06062                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04061   Viral protein interaction with cytokine and cytokine receptor ppad04062   Chemokine signaling pathway ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04623   Cytosolic DNA-sensing pathway ppad04668   TNF signaling pathway ppad05020   Prion disease ppad05142   Chagas disease ppad05163   Human cytomegalovirus infection ppad05164   Influenza A ppad05168   Herpes simplex virus 1 infection ppad05323   Rheumatoid arthritis ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     109251958 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109251958 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     109251958 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109251958 (CCL5)    04621 NOD-like receptor signaling pathway     109251958 (CCL5)    04623 Cytosolic DNA-sensing pathway     109251958 (CCL5)    04062 Chemokine signaling pathway     109251958 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109251958 (CCL5)    05168 Herpes simplex virus 1 infection     109251958 (CCL5)    05163 Human cytomegalovirus infection     109251958 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     109251958 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     109251958 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     109251958 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109251958 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109251958 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:ppad00536]     109251958 (CCL5) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Chemokines    109251958 (CCL5) Glycosaminoglycan binding proteins [BR:ppad00536]  Heparan sulfate / Heparin   Chemokines    109251958 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  109251958 NCBI-ProteinID:  XP_019279523 Ensembl:  ENSPPRG00000022842 UniProt:  A0A9V1EDR5 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSPAAFAVLLTAAAFCAPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP AVVFVTRRKRQVCANPQKKWVRDYINSLEMN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccccagctgcctttgcagtcctcctcactgctgccgctttctgcgctcct gcctctgcatccccatatgcctcggacaccaccccctgttgctttgcctacctctcccac ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg gtgcgggactacatcaactctttggagatgaactag

DBGET integrated database retrieval system