Panthera pardus (leopard): 109252011 Help Entry 109252011         CDS       T06062                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04061   Viral protein interaction with cytokine and cytokine receptor ppad04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109252011 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     109252011 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     109252011 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109252011 (CCL27) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Chemokines    109252011 (CCL27) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 VMAP-M1 Motif Other DBs NCBI-GeneID:  109252011 NCBI-ProteinID:  XP_019279621 Ensembl:  ENSPPRG00000024082 UniProt:  A0A9V1EDZ2 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MKGPSPTSSLLLLLLLLTPDPGAALLLSPSITCCTQLYRQPLSNKLLRKVIRVELQEADG DCHLQAFVLHLSRRSVCIHPQNRSLARWFERQGRRFQGILPNLNLELIEKMDQGP NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcacccacaagcagcctccttctgctactgctgctgctgaccccagac cctggagcagcactgctactgtcacccagcattacctgctgtactcagctctaccgccag ccactctcgaacaagctactgaggaaagtcatccgggtggaactgcaggaagctgatggg gactgtcacctccaggccttcgtgcttcacttgtctcgacgcagtgtctgcatccatcct cagaaccgcagcctggctcggtggtttgagcgccaagggaggagattccagggtattctg cctaacctgaatttggagctgatagagaaaatggaccaggggccctaa

DBGET integrated database retrieval system