Panthera pardus (leopard): 109252251 Help Entry 109252251         CDS       T06062                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism ppad  Panthera pardus (leopard) Pathway ppad04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109252251 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109252251 (NPS) Cytokines and neuropeptides [BR:ppad04052]  Neuropeptides   GPCR binding    109252251 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  109252251 NCBI-ProteinID:  XP_019280132 Ensembl:  ENSPPRG00000001364 UniProt:  A0A9V1EET9 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MISSLKFSLILLLLISTMHVFSSYPVPPSKVPGKSDYFLILLNSCPTRMDRSEGLDFLKP ILEKTFMKRKRSFRNGVGTGMKKTSFRRAKS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattagctcattaaaattcagtcttattctacttctgttgatttctacaatgcatgtg ttctcgtcttatcccgttccaccttctaaggtgcctggaaaatctgattactttctcatc ctgctgaacagctgcccaaccaggatggacaggagcgagggactagattttctaaagcca attttggagaagacattcatgaaaaggaaaaggtcctttcgcaatggagttggaacaggg atgaaaaaaacttcctttcgaagagcaaaatcatga

DBGET integrated database retrieval system