Panthera pardus (leopard): 109252384 Help Entry 109252384         CDS       T06062                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism ppad  Panthera pardus (leopard) Pathway ppad04613   Neutrophil extracellular trap formation ppad05034   Alcoholism ppad05203   Viral carcinogenesis ppad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109252384  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109252384   09163 Immune disease    05322 Systemic lupus erythematosus     109252384   09165 Substance dependence    05034 Alcoholism     109252384  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppad03036]     109252384   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109252384 Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109252384 Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109252384 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TAF Motif Other DBs NCBI-GeneID:  109252384 NCBI-ProteinID:  XP_019280351 UniProt:  A0A9V1EF63 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSAEHGQQQPSGGRRGRSSGDKKSKKRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDVFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagagcatggacagcagcagccgtcggggggccggaggggccgtagttctggc gacaagaagtccaaaaagcgcagccggcgcaaggagacctactcgatgtacatctacaag gtgctaaagcaggtgcaccctgacattggcatctcttccaaggccatgagcatcatgaat tcgtttgtgaacgatgtgtttgaacggctggctggcgaggctgcccggctggcccagtac tcgggccgaaccacactgacctcccgggaagtccagacggccgtgcgcctgctgctgccc ggggagctggccaagcacgccgtgtccgagggcaccaaggcggtcaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system