Panthera pardus (leopard): 109253332 Help Entry 109253332         CDS       T06062                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism ppad  Panthera pardus (leopard) Pathway ppad04360   Axon guidance ppad04666   Fc gamma R-mediated phagocytosis ppad04810   Regulation of actin cytoskeleton ppad05133   Pertussis ppad05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ppad00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109253332 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     109253332 (CFL2)   09158 Development and regeneration    04360 Axon guidance     109253332 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109253332 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     109253332 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109253332 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppad04812]     109253332 (CFL2)    04147 Exosome [BR:ppad04147]     109253332 (CFL2) Membrane trafficking [BR:ppad04131]  Others   Actin-binding proteins    Others     109253332 (CFL2) Cytoskeleton proteins [BR:ppad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      109253332 (CFL2) Exosome [BR:ppad04147]  Exosomal proteins   Proteins found in most exosomes    109253332 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  109253332 NCBI-ProteinID:  XP_019281721 Ensembl:  ENSPPRG00000007702 UniProt:  A0A9V1EHP4 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta agaaaatcttctacacaagaggagatcaaaaaaagaaagaaagccgttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgagagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggtattaaacatgaatggcaagtaaatggcttg gatgatataaaggaccgttcaacacttggagagaaattgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system