Panthera pardus (leopard): 109256040 Help Entry 109256040         CDS       T06062                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ppad  Panthera pardus (leopard) Pathway ppad04137   Mitophagy - animal ppad04140   Autophagy - animal ppad04144   Endocytosis ppad04145   Phagosome ppad04148   Efferocytosis ppad05132   Salmonella infection ppad05146   Amoebiasis ppad05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ppad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109256040 (RAB7A)    04145 Phagosome     109256040 (RAB7A)    04140 Autophagy - animal     109256040 (RAB7A)    04137 Mitophagy - animal     109256040 (RAB7A)    04148 Efferocytosis     109256040 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109256040 (RAB7A)    05152 Tuberculosis     109256040 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     109256040 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109256040 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109256040 (RAB7A)    04031 GTP-binding proteins [BR:ppad04031]     109256040 (RAB7A) Membrane trafficking [BR:ppad04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109256040 (RAB7A) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109256040 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    109256040 (RAB7A)   Exosomal proteins of colorectal cancer cells    109256040 (RAB7A)   Exosomal proteins of bladder cancer cells    109256040 (RAB7A) GTP-binding proteins [BR:ppad04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109256040 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  109256040 NCBI-ProteinID:  XP_019286509 Ensembl:  ENSPPRG00000003104 UniProt:  A0A9V1EQV7 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccagtcccttggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgtcactgcccccaacacattcaaaacccttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gtggtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system