Panthera pardus (leopard): 109257033 Help Entry 109257033         CDS       T06062                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ppad  Panthera pardus (leopard) Pathway ppad04382   Cornified envelope formation ppad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppad00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109257033 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109257033 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109257033 (S100A10) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of microglial cells    109257033 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  109257033 NCBI-ProteinID:  XP_019288437 UniProt:  A0A9W2UH59 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaacgatgatgttcacgttccacaagtttgct ggggacaaaggctacctaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaagataatgaaggacctagac cagtgccgggacggcagagtgggtttccagagcttcttttcgctgattgctgggctcacc atcgcatgcaatgactattttgtagttcacatgaagcagaaaggaaagaagtag

DBGET integrated database retrieval system