Panthera pardus (leopard): 109258517 Help Entry 109258517         CDS       T06062                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism ppad  Panthera pardus (leopard) Pathway ppad04081   Hormone signaling ppad04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     109258517 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     109258517 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109258517 (GAST) Cytokines and neuropeptides [BR:ppad04052]  Neuropeptides   GPCR binding    109258517 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  109258517 NCBI-ProteinID:  XP_019290900 Ensembl:  ENSPPRG00000007220 UniProt:  A0A9V1EXE2 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system