Panthera pardus (leopard): 109260743 Help Entry 109260743         CDS       T06062                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism ppad  Panthera pardus (leopard) Pathway ppad02010   ABC transporters ppad05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     109260743 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     109260743 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ppad02000]     109260743 (DEFB1)    03037 Cilium and associated proteins [BR:ppad03037]     109260743 (DEFB1) Transporters [BR:ppad02000]  Other transporters   Pores ion channels [TC:1]    109260743 (DEFB1) Cilium and associated proteins [BR:ppad03037]  Motile cilia and associated proteins   Sperm associated proteins    109260743 (DEFB1) SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  109260743 NCBI-ProteinID:  XP_019294715 UniProt:  A0A9V1F3G9 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga ggaacctgtaacttttctccatgcccactttttaccaggatcgatggcacctgctatggt ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system