Panthera pardus (leopard): 109260946 Help Entry 109260946         CDS       T06062                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism ppad  Panthera pardus (leopard) Pathway ppad04015   Rap1 signaling pathway ppad04810   Regulation of actin cytoskeleton ppad05014   Amyotrophic lateral sclerosis ppad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109260946 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109260946 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109260946 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109260946 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109260946 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppad04812]     109260946 (PFN2)    04147 Exosome [BR:ppad04147]     109260946 (PFN2) Membrane trafficking [BR:ppad04131]  Others   Actin-binding proteins    Others     109260946 (PFN2) Cytoskeleton proteins [BR:ppad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109260946 (PFN2) Exosome [BR:ppad04147]  Exosomal proteins   Proteins found in most exosomes    109260946 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109260946 NCBI-ProteinID:  XP_019294995 Ensembl:  ENSPPRG00000023714 UniProt:  A0A9V1F407 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system