Panthera pardus (leopard): 109261307 Help Entry 109261307         CDS       T06062                                  Name (RefSeq) interferon alpha   KO K05414   interferon alpha Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04151   PI3K-Akt signaling pathway ppad04217   Necroptosis ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04622   RIG-I-like receptor signaling pathway ppad04623   Cytosolic DNA-sensing pathway ppad04630   JAK-STAT signaling pathway ppad04650   Natural killer cell mediated cytotoxicity ppad04936   Alcoholic liver disease ppad05152   Tuberculosis ppad05160   Hepatitis C ppad05161   Hepatitis B ppad05162   Measles ppad05163   Human cytomegalovirus infection ppad05164   Influenza A ppad05165   Human papillomavirus infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05168   Herpes simplex virus 1 infection ppad05169   Epstein-Barr virus infection ppad05170   Human immunodeficiency virus 1 infection ppad05171   Coronavirus disease - COVID-19 ppad05200   Pathways in cancer ppad05320   Autoimmune thyroid disease ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109261307    04151 PI3K-Akt signaling pathway     109261307   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109261307  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109261307  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109261307    04621 NOD-like receptor signaling pathway     109261307    04622 RIG-I-like receptor signaling pathway     109261307    04623 Cytosolic DNA-sensing pathway     109261307    04650 Natural killer cell mediated cytotoxicity     109261307  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109261307   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109261307    05161 Hepatitis B     109261307    05160 Hepatitis C     109261307    05171 Coronavirus disease - COVID-19     109261307    05164 Influenza A     109261307    05162 Measles     109261307    05168 Herpes simplex virus 1 infection     109261307    05163 Human cytomegalovirus infection     109261307    05167 Kaposi sarcoma-associated herpesvirus infection     109261307    05169 Epstein-Barr virus infection     109261307    05165 Human papillomavirus infection     109261307   09171 Infectious disease: bacterial    05152 Tuberculosis     109261307   09163 Immune disease    05320 Autoimmune thyroid disease     109261307   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109261307   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109261307  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109261307 Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interferons    109261307 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109261307 NCBI-ProteinID:  XP_019295413 Ensembl:  ENSPPRG00000011719 UniProt:  A0A9W2W1A6 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPHTHGLLNRRALTLLEQMRRLPASSCQKDRNDFA FPRDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVMQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEVVRAEIMRSLYYSSIA LQKRLRSEK NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tctctgggctgtgacctgcctcacacccacggcctgctgaacaggagggccttgacgctc ctggaacaaatgaggagactccctgccagctcctgccagaaggacagaaatgacttcgcc ttcccccgggacgtgtttggtggagaccagtcccacaaggcccaagccctctctgtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcatgcaggaggtgggggagggagaggctcccctcaccaacgaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggaggtcgtcagagcagaaattatgaggtccttgtattattcatcaatagcc ttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system