Panthera pardus (leopard): 109264514 Help Entry 109264514         CDS       T06062                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha isoform X1   KO K04383   interleukin 1 alpha Organism ppad  Panthera pardus (leopard) Pathway ppad04010   MAPK signaling pathway ppad04060   Cytokine-cytokine receptor interaction ppad04217   Necroptosis ppad04218   Cellular senescence ppad04380   Osteoclast differentiation ppad04640   Hematopoietic cell lineage ppad04932   Non-alcoholic fatty liver disease ppad04933   AGE-RAGE signaling pathway in diabetic complications ppad04940   Type I diabetes mellitus ppad05010   Alzheimer disease ppad05020   Prion disease ppad05022   Pathways of neurodegeneration - multiple diseases ppad05133   Pertussis ppad05140   Leishmaniasis ppad05152   Tuberculosis ppad05162   Measles ppad05164   Influenza A ppad05321   Inflammatory bowel disease ppad05323   Rheumatoid arthritis ppad05332   Graft-versus-host disease ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109264514 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109264514 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109264514 (IL1A)    04218 Cellular senescence     109264514 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109264514 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     109264514 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109264514 (IL1A)    05162 Measles     109264514 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     109264514 (IL1A)    05152 Tuberculosis     109264514 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109264514 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     109264514 (IL1A)    05321 Inflammatory bowel disease     109264514 (IL1A)    05332 Graft-versus-host disease     109264514 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     109264514 (IL1A)    05020 Prion disease     109264514 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     109264514 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109264514 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109264514 (IL1A)    04932 Non-alcoholic fatty liver disease     109264514 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     109264514 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109264514 (IL1A) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interleukins    109264514 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep DUF6108 Motif Other DBs NCBI-GeneID:  109264514 NCBI-ProteinID:  XP_019300357 Ensembl:  ENSPPRG00000005848 UniProt:  A0A9V1FD53 LinkDB All DBs Position Unknown AA seq 270 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYNSEVDHLTLNQKSFYDASYDPLHEDCTDKFMSPSTSETS KTSQLTLKESVVMVVANGKILKKRRLSLNQFLTADDLEAIANEVEEEIMKPRSVAPNFYS SEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKL PVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPK LFIATREEKLVHMARGLPSVTDFQILETQS NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcctgacctctttgaagacctgaagaactgttacagtgaaaatgaagaa tacaattctgaagttgaccatctcactctgaatcagaaatccttctatgatgcaagctat gacccacttcatgaggactgtacagataaatttatgtctccgagtacttctgaaacctcc aagacatcccagcttaccctcaaggagagtgtagtgatggtggtagccaatgggaagatt ctgaagaagaggcggttgagtttaaatcaattcctcactgctgatgacctggaagccatt gcaaacgaagtagaagaagaaatcatgaagcccagatcagtagcacccaacttctatagc agtgaaaaatacaactatcagaagatcatcaaatcccaattcatcctgaatgacaacctc agtcaaagtgtaattcgaaaagcagggggaaaatacctcgcagccgctgcattacagaat ctggatgatgcagtgaaatttgacatgggggcttatacatcaaaagaagattctaaactt cctgtgactctcagaatctcaaaaactcgactgtttgtgagtgctcaaaatgaagatgag cctgtattgctaaaggagatgcctgagacacccaaaaccatcagagatgagaccaacctt ctcttcttctgggaacgtcatggcagtaagaactacttcaaatcagttgcccatccaaag ttgttcattgccacacgggaagaaaaactggtgcacatggcaagagggctaccctctgtc actgactttcagatactggaaacccagtcttga

DBGET integrated database retrieval system