Panthera pardus (leopard): 109264906 Help Entry 109264906         CDS       T06062                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism ppad  Panthera pardus (leopard) Pathway ppad04022   cGMP-PKG signaling pathway ppad04081   Hormone signaling ppad04270   Vascular smooth muscle contraction ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     109264906 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     109264906 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     109264906 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109264906 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109264906 (NPPC) Cytokines and neuropeptides [BR:ppad04052]  Neuropeptides   Unclassified    109264906 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  109264906 NCBI-ProteinID:  XP_019301119 Ensembl:  ENSPPRG00000017667 UniProt:  A0A9V1FEE9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccaggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggtggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaggga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system