Panthera pardus (leopard): 109267585 Help Entry 109267585         CDS       T06062                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism ppad  Panthera pardus (leopard) Pathway ppad04015   Rap1 signaling pathway ppad04810   Regulation of actin cytoskeleton ppad05014   Amyotrophic lateral sclerosis ppad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109267585 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109267585 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109267585 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109267585 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109267585 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppad04812]     109267585 (PFN3)    04147 Exosome [BR:ppad04147]     109267585 (PFN3) Membrane trafficking [BR:ppad04131]  Others   Actin-binding proteins    Others     109267585 (PFN3) Cytoskeleton proteins [BR:ppad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109267585 (PFN3) Exosome [BR:ppad04147]  Exosomal proteins   Proteins found in most exosomes    109267585 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109267585 NCBI-ProteinID:  XP_019306006 UniProt:  A0A9V1FNJ6 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELINGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcagtgctgcgggaccagcgtattgatgacgtg gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccacaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgtgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgcgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system