Panthera pardus (leopard): 109269986 Help Entry 109269986         CDS       T06062                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ppad  Panthera pardus (leopard) Pathway ppad04621   NOD-like receptor signaling pathway ppad05012   Parkinson disease ppad05132   Salmonella infection ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109269986 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109269986 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     109269986 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109269986 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppad03110]     109269986 (TXN) Chaperones and folding catalysts [BR:ppad03110]  Protein folding catalysts   Protein disulfide isomerase    109269986 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  109269986 NCBI-ProteinID:  XP_019309775 Ensembl:  ENSPPRG00000023724 UniProt:  A0A9V1FV42 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system