Panthera pardus (leopard): 109270310 Help Entry 109270310         CDS       T06062                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism ppad  Panthera pardus (leopard) Pathway ppad04014   Ras signaling pathway ppad04137   Mitophagy - animal ppad04144   Endocytosis ppad04145   Phagosome ppad04148   Efferocytosis ppad04962   Vasopressin-regulated water reabsorption ppad05132   Salmonella infection ppad05146   Amoebiasis ppad05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109270310 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109270310 (RAB5B)    04145 Phagosome     109270310 (RAB5B)    04137 Mitophagy - animal     109270310 (RAB5B)    04148 Efferocytosis     109270310 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     109270310 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109270310 (RAB5B)    05152 Tuberculosis     109270310 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     109270310 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109270310 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109270310 (RAB5B)    04031 GTP-binding proteins [BR:ppad04031]     109270310 (RAB5B) Membrane trafficking [BR:ppad04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     109270310 (RAB5B)  Endosome - Lysosome transport     109270310 (RAB5B) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109270310 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    109270310 (RAB5B)   Exosomal proteins of colorectal cancer cells    109270310 (RAB5B)   Exosomal proteins of melanoma cells    109270310 (RAB5B) GTP-binding proteins [BR:ppad04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     109270310 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  109270310 NCBI-ProteinID:  XP_019310273 Ensembl:  ENSPPRG00000005396 UniProt:  A0A9W2UVV3 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt gtcaaagggcagtttcatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatttgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgctcgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag ctgccaaagagcgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system